PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna03817.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 361aa    MW: 39442.9 Da    PI: 6.6027
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna03817.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  mrna03817.1-v1.0-hybrid 14 KGPWTPEEDIILVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                             79******************************99************97 PP

2Myb_DNA-binding48.22.5e-1567112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T  E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  mrna03817.1-v1.0-hybrid  67 RGNFTDHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.805965IPR017930Myb domain
SuperFamilySSF466894.49E-3011108IPR009057Homeodomain-like
SMARTSM007172.0E-141363IPR001005SANT/Myb domain
PfamPF002493.8E-161461IPR001005SANT/Myb domain
CDDcd001671.96E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.21666116IPR017930Myb domain
SMARTSM007174.0E-1566114IPR001005SANT/Myb domain
PfamPF002499.7E-1467112IPR001005SANT/Myb domain
CDDcd001677.52E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGRPPCCDKE GVKKGPWTPE EDIILVSYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TDHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLNKLT  120
QIGGHSRDEG FTSNCSQQAT IARGQWERRL QTDIHTARQA LREALSPSEN YKTDAFASTM  180
SLSSTSTSTS TDSKPLMNIV PAGQSPSNTL STTYASSTEN ISRLLKGWMK NPPKSAKAST  240
TAAAGVLDST SSNEEATLSA ANTITTTSTT GHGNVELSNA LESLFGLEGS LEASNSDLSP  300
TMSPDQGSLF QAESKPDVDQ DQLPLSLLEK WLFDEAAVIH GKEVHFSDFM SLDGENAGFF  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-25141164105C-Myb DNA-Binding Domain
1mse_C1e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304297.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-116MYB06_ANTMA; Myb-related protein 306
TrEMBLD9ZJ581e-149D9ZJ58_MALDO; MYB domain class transcription factor
STRINGVIT_14s0108g00830.t011e-131(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.14e-98myb domain protein 30